This is a working overview of reduced glutathione, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-02-21 and is reviewed periodically as new material appears.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It occurs in nearly all living cells, with highest concentrations in liver, kidney, and red blood cells, and exists in reduced (GSH) and oxidized disulfide (GSSG) forms. The cysteine thiol group enables reversible oxidation and reduction reactions. This property makes glutathione a central participant in cellular redox balance. The balance between these forms is often used as an indicator of oxidative stress.
Glutathione synthesis proceeds in two ATP-dependent steps catalyzed by glutamate-cysteine ligase and glutathione synthetase. The first step joins glutamate and cysteine to form gamma-glutamylcysteine and is generally rate-limiting. The second step adds glycine to complete the tripeptide. Cysteine availability, feedback inhibition by glutathione, and oxidative conditions influence flux through this pathway. The pathway is conserved across many organisms, and degradation by gamma-glutamyl transpeptidase and related peptidases recycles amino acids for new synthesis.
In cells, glutathione exists mainly in a reduced form called GSH. When two GSH molecules react, they form oxidized glutathione, or GSSG, which contains a disulfide bond. The ratio of GSH to GSSG is often used as an indicator of oxidative stress. Enzymes such as glutathione peroxidase and glutathione reductase help cycle the molecule between these two states. This cycling supports antioxidant defense, detoxification of reactive molecules, and regulation of certain signaling pathways.
Glutathione is present in most tissues, with especially high concentrations in the liver. It also serves as a cofactor for some enzymes and helps transport amino acids across cell membranes. In plants and microorganisms, glutathione contributes to stress responses and metal handling. The molecule is synthesized in two ATP-dependent steps, first producing gamma-glutamylcysteine and then adding glycine. Because cysteine availability often limits synthesis, dietary and metabolic factors can influence glutathione levels. Research continues to examine how these levels relate to health and disease.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group. This unusual linkage protects the molecule from many common peptidases. The cysteine side chain carries a thiol group that can undergo reversible oxidation. Because of this thiol, glutathione participates in redox reactions and helps maintain the reducing environment inside most cells in living systems.
| Property | Value | Notes |
|---|---|---|
| Common name | Glutathione | Reduced form is abbreviated GSH |
| Chemical class | Tripeptide | Composed of glutamate, cysteine, and glycine |
| Molar mass | 307.32 g/mol | For reduced glutathione |
| CAS Registry Number | 70-18-8 | For reduced L-glutathione |
| Appearance | White crystalline powder | Typical solid reference material |
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its cysteine residue carries a thiol group, which allows the molecule to participate in reduction and oxidation reactions. The compound exists in most living cells, where the reduced form, often abbreviated GSH, is usually more abundant than the oxidized disulfide form, GSSG. Intracellular concentrations are commonly in the millimolar range, while extracellular concentrations are much lower. This uneven distribution supports its role as a major cellular redox buffer.
Cells synthesize glutathione through two ATP-dependent enzymatic steps. The first step combines glutamate and cysteine to form gamma-glutamylcysteine, catalyzed by glutamate-cysteine ligase. The second step adds glycine, producing the complete tripeptide, catalyzed by glutathione synthetase. Glutathione itself can inhibit the first enzyme, providing negative feedback when levels are high. Because cysteine is often limiting, its availability influences how quickly the pathway proceeds. These reactions occur in the cytosol, and the resulting glutathione can be distributed to other compartments.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Glutathione supports detoxification by conjugating reactive electrophiles through glutathione S-transferases. The resulting conjugates are processed and exported, often after further metabolism. It also stores cysteine, transports amino acids across membranes through the gamma-glutamyl cycle, and assists in the maturation of iron-sulfur clusters and some prostaglandins. In plants, animals, and many microbes, the molecule appears in similar roles, but concentrations vary enormously between tissues. Liver, kidney, and red blood cells tend to contain high amounts, while blood plasma contains much less.
Glutathione is a small tripeptide built from glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group, a linkage that resists ordinary peptidases. Cells make it in two ATP-dependent steps: gamma-glutamylcysteine synthetase joins glutamate and cysteine, then glutathione synthetase adds glycine. The pathway is feedback-inhibited by glutathione itself, so intracellular levels tend to stay within a narrow range. Because cysteine is often limiting, sulfur amino acid supply influences how much glutathione a cell can produce.
In its reduced form, glutathione carries a sulfhydryl group that can donate electrons. This property lets it act as a major cellular antioxidant and redox buffer. Glutathione peroxidase uses it to reduce hydrogen peroxide and lipid peroxides, while glutathione reductase regenerates the reduced form using NADPH. The ratio of reduced glutathione to glutathione disulfide is widely used as an indicator of oxidative stress, though the ratio changes with compartment, cell type, and sample handling. Oxidized glutathione can also form mixed disulfides with proteins, affecting their activity.
In cells, glutathione helps maintain the reducing environment of the cytosol and supports enzymes that counteract reactive oxygen species. It acts as a cofactor for glutathione peroxidases, which reduce hydrogen peroxide and lipid peroxides, and for glutathione S-transferases, which conjugate electrophiles. The ratio of GSH to GSSG is often used as an indicator of oxidative stress, although the ratio can vary by compartment and cell type. Glutathione also stores cysteine, an amino acid that can be limiting for protein synthesis and antioxidant defense.
Synthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine to form gamma-glutamylcysteine, and glutathione synthetase adds glycine. The first step is rate-limiting and is influenced by cysteine availability and feedback inhibition by GSH. Breakdown involves gamma-glutamyl transferase and subsequent peptidases, which release constituent amino acids for reuse. Because turnover differs among tissues, measurements from blood, plasma, and tissues are not directly interchangeable. Research continues to clarify how compartment-specific pools are regulated in health and disease.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It contains an unusual gamma-glutamyl bond between glutamate and cysteine, which resists cleavage by many peptidases. The reduced form, GSH, carries a thiol group on cysteine and is the dominant intracellular form in most cells. Its structure allows it to participate in redox reactions and to serve as a sulfur donor. The oxidized form, GSSG, consists of two GSH molecules joined by a disulfide bond.
=== Food industry === Steel belts used in the food business are made to be sanitary, simple to clean, dependable, and flexible in their use. They are employed in the cooking process as well as the drying and steaming of perishables, the freeze-drying of instant coffee, the casting of caramel and other candies, and the formation of chocolate droplets.
Israel started evacuating the settlements located close to the border with Lebanon in October 2023 with more than 60 thousand evacuated by April 2024. In the early afternoon of 21 October, several rockets were fired from Lebanon toward the Shebaa Farms; there were no injuries. The IDF conducted a drone strike on the team of militants that launched the rockets. A short while later, anti-tank guided missiles were fired from Lebanon toward Margaliot and Hanita; two foreign workers were injured. The IDF conducted airstrikes against the missile teams. In the evening, another anti-tank guided missile was fired from Lebanon toward Bar'am. One IDF soldier was seriously injured and two others suffered minor injuries. The IDF responded with several airstrikes in southern Lebanon, some of which targeted other missile teams preparing attacks. The IDF conducted airstrikes against two Syrian military positions on 24 October in southwestern Syria, marking the first time the IDF publicly targeted the Syrian military since the Israel–Gaza war began. Hezbollah attacked 19 IDF military sites with missiles and artillery shells and fired one-way attack drones at an IDF position for the first time since the conflict began.
=== Pharmacokinetics === Exposure to radioactive waste may cause health impacts due to ionizing radiation exposure. In humans, a dose of 1 sievert carries a 5.5% risk of developing cancer, and regulatory agencies assume the risk is linearly proportional to dose even for low doses. Ionizing radiation can cause deletions in chromosomes. If a developing organism such as a fetus is irradiated, it is possible a birth defect may be induced, but it is unlikely this defect will be in a gamete or a gamete-forming cell. The incidence of radiation-induced mutations in humans is small, as in most mammals, because of natural cellular-repair mechanisms, many just now coming to light. These mechanisms range from DNA, mRNA and protein repair, to internal lysosomic digestion of defective proteins, and even induced cell suicide—apoptosis Depending on the decay mode and the pharmacokinetics of an element (how the body processes it and how quickly), the threat due to exposure to a given activity of a radioisotope will differ. For instance, iodine-131 is a short-lived beta and gamma emitter, but because it concentrates in the thyroid gland, it is more able to cause injury than caesium-137 which, being water soluble, is rapidly excreted through urine. In a similar way, the alpha emitting actinides and radium are considered very harmful as they tend to have long biological half-lives and their radiation has a high relative biological effectiveness, making it far more damaging to tissues per amount of energy deposited.
Granulocyte colony-stimulating factor (G-CSF or GCSF), also known as colony-stimulating factor 3 (CSF 3), is a glycoprotein that stimulates the bone marrow to produce granulocytes and stem cells and release them into the bloodstream. Functionally, it is a cytokine and hormone, a type of colony-stimulating factor, and is produced by a number of different tissues. The pharmaceutical analogs of naturally occurring G-CSF are called filgrastim and lenograstim. G-CSF also stimulates the survival, proliferation, differentiation, and function of neutrophil precursors and mature neutrophils.
Sources: en.wikipedia.org
== Academics == Emerson University offers undergraduate and postgraduate programmes — including BS (four-year), M.Phil. and PhD degrees — across the arts and humanities, social sciences, natural sciences, management sciences and computer science. Intermediate-level programmes (FA, FSc, ICom and ICS) inherited from the predecessor college continue to be offered.
== Friends == The Friends of the Natural History Museum Paris is a private organisation that provides financial support for the MNHN, its branches and the Jardin des Plantes. Membership includes free entry to all galleries of the museum and the botanical garden. The Friends have assisted the museum with many purchases for its collections over the years, as well as funds for scientific and structural development.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The SNX8 is a sorting nexin protein involved in intracellular molecular traffic from the early endosomes to the trans-golgi network. It is suggested that it acts as an adaptor protein in events related to immune response and cholesterol regulation, for example. As a protein of the SNXs family, the SNX8 is formed of 465 aminoacids and presents a BAR domain and a PX domain which are very relevant in relation to its functions. Furthermore, SNX8 study is motivated by its medical significance in relation to diseases such as Alzheimer's Disease, cancer, neurodevelopmental malformations and to its role in fighting against viral infections.
=== Xenon-135 oscillations === The interdependence of 135Xe buildup and the neutron flux can lead to periodic power fluctuations. In large reactors, with little neutron flux coupling between their regions, flux nonuniformities can lead to formation of xenon oscillations, periodic local variations of reactor power moving through the core with a period of about 15 hours. A local variation of neutron flux causes increased burnup of 135Xe and production of 135I, depletion of 135Xe increases the reactivity in the core region. The local power density can change by a factor of three or more, while the average power of the reactor stays more or less unchanged. Strong negative temperature coefficient of reactivity causes damping of these oscillations, and is a desired reactor design feature.
Sources: en.wikipedia.org
GSH is the reduced thiol form, while GSSG is the disulfide-linked oxidized dimer. The GSH:GSSG ratio is used as a redox indicator, though the ratio can vary with sample handling and cell type.
Glutathione is present in many foods, including meats, poultry, fish, some vegetables, and fruits. Cooking, storage, and digestion affect the amounts available for absorption.
Yes, both enzymatic steps in glutathione synthesis consume ATP. The first step, catalyzed by glutamate-cysteine ligase, is usually rate-limiting.
Glutathione is a tripeptide made from glutamate, cysteine, and glycine. Its cysteine residue provides a thiol group that is central to its redox activity. The glutamate-cysteine bond forms through the gamma-carboxyl group of glutamate.