A practical reference on derivatization: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-08-22. Anything still debated is marked as such rather than presented as settled.
For solid glutathione, storage conditions affect shelf life. The reduced form is typically kept cool, dry, and protected from air and light. Moisture can promote oxidation, while elevated temperatures accelerate degradation. Suppliers often specify storage at or below freezing, sometimes under inert gas. Solutions are less stable than powders and may require preparation shortly before use. Buffers and chelating agents can slow oxidation, but they do not eliminate it. Published stability data vary with matrix, pH, and container.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
Within cells, glutathione serves as a cofactor for glutathione peroxidases and glutathione S-transferases. These enzymes reduce hydrogen peroxide and organic peroxides or conjugate electrophilic compounds to the thiol group. The resulting conjugates can be exported and processed through mercapturic acid pathways. Glutathione also contributes to protein thiol homeostasis and to recycling of other antioxidants such as ascorbate. Its precise roles vary by tissue, and many regulatory effects observed in laboratory systems remain difficult to quantify in whole organisms.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It occurs in nearly all living cells, with highest concentrations in liver, kidney, and red blood cells, and exists in reduced (GSH) and oxidized disulfide (GSSG) forms. The cysteine thiol group enables reversible oxidation and reduction reactions. This property makes glutathione a central participant in cellular redox balance. The balance between these forms is often used as an indicator of oxidative stress.
| Property | Value | Notes |
|---|---|---|
| Typical assay | HPLC-UV or LC-MS/MS | Derivatization may improve detection |
| Storage temperature | -20 °C or below | Keep desiccated and protected from light |
| Appearance | White to off-white crystalline powder | Reduced form |
| Solubility | Freely soluble in water | Insoluble in lipids and nonpolar solvents |
| Common synonyms | L-Glutathione; GSH | GSH denotes reduced form |
Quality control for glutathione measurements includes calibration with authenticated standards, internal standards where available, blank correction, and spike recovery checks. Because glutathione can form during sample processing or degrade before analysis, pre-analytical handling is a major source of variability. Interlaboratory comparisons often show differences in reported values due to method-specific calibration and detection principles. Interpretive thresholds are context-dependent, and no single reference range applies across all tissues or matrices. Researchers generally report both reduced and oxidized forms, along with the method and sample handling details.
Quantification of glutathione in biological or food samples commonly uses liquid chromatography coupled to ultraviolet, fluorescence, electrochemical, or mass spectrometric detection. Because the thiol group oxidizes readily, samples are often acidified or derivatized immediately after collection to stabilize reduced glutathione. Enzymatic recycling assays and colorimetric kits offer higher throughput but generally lower specificity than chromatographic methods. Mass spectrometry can distinguish glutathione from related thiols and allow simultaneous measurement of oxidized forms. Reported concentrations depend strongly on sample type, extraction procedure, and analytical platform.
Biosynthesis proceeds in two ATP-dependent steps. First, glutamate-cysteine ligase joins glutamate and cysteine. Second, glutathione synthetase adds glycine to the intermediate. The pathway is regulated by cysteine availability, enzyme expression, and feedback inhibition by glutathione itself. Liver tissue has a particularly high capacity for synthesis and export. Because the molecule is made inside cells, circulating glutathione reflects a balance of release, uptake, and breakdown rather than simple dietary supply.
Functionally, glutathione supports redox balance by donating electrons and becoming oxidized. It also serves as a cofactor for enzymes such as glutathione peroxidases and glutathione S-transferases. These enzymes participate in peroxide reduction and in conjugation reactions that help process reactive molecules. Separate from antioxidant roles, glutathione can modify protein cysteines through S-glutathionylation, influencing enzyme activity and signaling. Research continues to examine how these chemical roles translate into whole-organism effects.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its glutamate-cysteine linkage uses the gamma-carboxyl group of glutamate, a feature that resists standard peptidases. The cysteine residue provides a thiol group, which gives the molecule its reducing character. In cells, glutathione is often the most abundant small-molecule thiol, with concentrations varying widely by tissue and compartment. It exists mainly in a reduced form called GSH, while oxidation produces a disulfide-linked dimer called GSSG.
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
Tolkien never expected his stories to become popular, but by sheer accident a book called The Hobbit, which he had written some years before for his own children, came in 1936 to the attention of Susan Dagnall, an employee of the London publishing firm George Allen & Unwin, who persuaded Tolkien to submit it for publication. When it was published a year later, the book attracted adult readers as well as children, and it became popular enough for the publishers to ask Tolkien to produce a sequel.
=== Therapy === Weight loss and problems in eating due to dysphagia and other muscle discoordination are common, making nutrition management increasingly important as the disease advances. Thickening agents can be added to liquids, as thicker fluids are easier and safer to swallow. Reminding the affected person to eat slowly and to take smaller pieces of food into the mouth may also be of use to prevent choking. If eating becomes too hazardous or uncomfortable, the option of using a percutaneous endoscopic gastrostomy is available. This feeding tube, permanently attached through the abdomen into the stomach, reduces the risk of aspirating food and provides better nutritional management. Assessment and management by speech-language pathologists with experience in Huntington's disease is recommended. People with Huntington's disease may see a physical therapist for noninvasive and nonmedication-based ways of managing the physical symptoms. Physical therapists may implement fall risk assessment and prevention, as well as strengthening, stretching, and cardiovascular exercises. Walking aids may be prescribed as appropriate. Physical therapists also prescribe breathing exercises and airway clearance techniques with the development of respiratory problems. Consensus guidelines on physiotherapy in Huntington's disease have been produced by the European HD Network. Goals of early rehabilitation interventions are prevention of loss of function.
In the case of recreational substance use, harm reduction is put forward as a useful perspective alongside the more conventional approaches of demand and supply reduction. Many advocates argue that prohibitionist laws criminalise people for suffering from a disease and cause harm for example, by obliging people who use substances to obtain substances of unknown purity from unreliable criminal sources at high prices, thereby increasing the risk of overdose and death. The web forum Bluelight allows users to share information and first-hand experience reports about various psychoactive substances and harm reduction practices. The website Erowid collects and publishes information and first-hand experience reports about all kinds of substances to educate people who use or may use substances. While the vast majority of harm reduction initiatives are educational campaigns or facilities that aim to reduce substance-related harm, a unique social enterprise was launched in Denmark in September 2013 to reduce the financial burden of illicit substance use for people with a drug dependence. Michael Lodberg Olsen, who was previously involved with the establishment of a substance consumption facility in Denmark, announced the founding of the Illegal magazine that will be sold by people who use substances in Copenhagen and the district of Vesterbro, who will be able to direct the profits from sales towards drug procurement.
=== Transformation in the environment === The silver nanoparticles that pass through wastewater treatment plants undergo transformations in the environment through changes in aggregation state, oxidation state, precipitation of secondary phases, or sorption of organic species. These transformations can result in the formation of colloidal solutions. Each of these new species potentially have toxic effects which have yet to be fully examined. Most silver nanoparticles in products have an organic shell structure around a core of Ag0. This shell is often created with carboxylic acids functional groups, usually using citrate, leading to stabilization through adsorption or covalent attachment of organic compounds. In seawater, glutathione reacts with citrate to form a thioester via esterification.
== Organization == The LLNL director is supported by a senior executive team consisting of the deputy director, the deputy director for science and technology, principal associate directors, and other senior executives who manage areas/functions directly reporting to the laboratory director. The director's office is organized into these functional areas/offices:
Sources: en.wikipedia.org
As a tracer for cobalt in chemical reactions Sterilization of medical equipment. Radiation source for medical radiotherapy; specifically cobalt therapy, which uses beams of gamma rays from 60Co teletherapy machines. Radiation source for industrial radiography. Radiation source for leveling devices and thickness gauges. Radiation source for pest insect sterilization. As a radiation source for food irradiation and blood irradiation. As a primary standard for radiation dosimetry calibration. Cobalt has been discussed as a "salting" element to add to nuclear weapons, to produce a cobalt bomb, an extremely "dirty" weapon which would contaminate large areas with 60Co nuclear fallout, rendering them uninhabitable for a decade or more (multiple half-lives of cobalt-60) due to the gamma radiation field. In one design, the tamper of the weapon would be made of 59Co (natural cobalt). When the bomb explodes, neutrons from the nuclear fission would irradiate the cobalt and transmute it to 60Co. No country is known to have done any serious development of this type of weapon.
Brain-specific angiogenesis inhibitor InterPro: IPR008077 BAI1; BAI2; BAI3 CD97 antigen InterPro: IPR003056 CD97 EMR hormone receptor InterPro: IPR001740 CELSR1; CELSR2; CELSR3; EMR1; EMR2; EMR3; EMR4 GPR56 orphan receptor InterPro: IPR003910 GPR56; GPR64; GPR97; GPR110; GPR111; GPR112; GPR113; GPR114; GPR115; GPR123; GPR125; GPR126; GPR128; GPR133; GPR144; GPR157 Latrophilin receptor InterPro: IPR003924 ELTD1; LPHN1; LPHN2; LPHN3 Ig-hepta receptor InterPro: IPR008078 GPR116
Augustus is shown in his role of imperator, the commander of the army, as thoracatus —or commander-in-chief of the Roman army (literally, thorax-wearer)—meaning the statue should form part of a commemorative monument to his latest victories; he is in military clothing, carrying what may have been a spear or a consular baton, and raising his right hand in a rhetorical adlocutio pose, addressing the troops. The bas-reliefs on his armored cuirass have a complex allegorical and political agenda, alluding to diverse Roman deities, including Mars, god of war, as well as the personifications of the latest territories he conquered: Hispania, Gaul, Germania, Parthia (that had humiliated Crassus, and here appears in the act of returning the standards captured from his legions); at the top, the chariot of the Sun illuminates Augustus's deeds. The statue is an idealized image of Augustus showing a standard pose of a Roman orator and based on the 5th-century BC statue of the Spear Bearer or Doryphoros by the sculptor Polykleitos. The Doryphoros's contrapposto stance, creating diagonals between tense and relaxed limbs, a feature typical of classical sculpture, is adapted here. The pose of the statue's legs is similar to Doryphoros. The right leg is taut, while the left leg is relaxed, as if the statue is moving forward. The misidentification of the Doryphoros in the Roman period as representing the warrior Achilles made the model all the more appropriate for this image.
The waves were focused (by curving the antenna) and refracted (by a prism-shaped graphene bilayer because the conductivity in the two-atom-thick prism is larger than in the surrounding one-atom-thick layer.) The plasmonic metal-graphene nanoantenna was composed by inserting a few nanometers of oxide between a dipole gold nanorod and the monolayer graphene. The used oxide layer here can reduce the quantum tunneling effect between graphene and metal antenna. With tuning the chemical potential of the graphene layer through field effect transistor architecture, the in-phase and out-phase mode coupling between graphene plasmonics and metal plasmonics is realized. The tunable properties of the plasmonic metal-graphene nanoantenna can be switched on and off via modifying the electrostatic gate-voltage on graphene.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
Common methods include spectrophotometric enzyme cycling assays, HPLC with UV or fluorescence detection, and LC-MS/MS. Detection often requires derivatization because glutathione lacks a strong chromophore. Method choice depends on the sample type and the required sensitivity.
Yes, especially in solution or when exposed to oxygen, light, and heat. The reduced form can oxidize to GSSG or form disulfides with other thiols. Powdered material stored cool and dry is generally more stable than aqueous preparations.
Purity refers to the proportion of the intended compound in a sample, often determined by chromatography. A high purity value does not necessarily indicate a specific oxidation state. Buyers may also need information about GSSG content, water, and residual solvents.
GSH is the reduced thiol form, while GSSG is the disulfide-linked oxidized dimer. The GSH:GSSG ratio is used as a redox indicator, though the ratio can vary with sample handling and cell type.